PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf02501g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 192aa    MW: 21646.9 Da    PI: 8.2696
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf02501g00004.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF37.43.3e-12641540
                              SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE CS
                    SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviif 40
                              +k  r v ++  +n++ KKA E+S+LC++e+a+iif
  Peinf101Scf02501g00004.1  6 DKHSRDVALTHMQNTLCKKAMEISILCGIEIAIIIF 41
                              78899*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004320.0074153IPR002100Transcription factor, MADS-box
PROSITE profilePS5006612.18154IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-13270IPR002100Transcription factor, MADS-box
PfamPF003197.1E-9641IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MRLTRDKHSR DVALTHMQNT LCKKAMEISI LCGIEIAIII FRLGDPPVLY GNPDVESVVN  60
KFLKAQLTKC LSYRCMLCER ASCREERCKM VKKGKELQAN DENQNYVDGW FKRFTSKNFE  120
AADLGRVEQL NQKIYKLSKY LNNEIVLLQS AIGADDSKST EGMNLTGSED PKSVSEISVA  180
SSSTISPNWL SL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22971258
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.11e-11AGAMOUS-like 29